-
Notifications
You must be signed in to change notification settings - Fork 30
User defined rules #21
New issue
Have a question about this project? Sign up for a free GitHub account to open an issue and contact its maintainers and the community.
By clicking “Sign up for GitHub”, you agree to our terms of service and privacy statement. We’ll occasionally send you account related emails.
Already on GitHub? Sign in to your account
Open
dansuissa
wants to merge
2
commits into
Adibvafa:main
Choose a base branch
from
dansuissa:user-defined-rules
base: main
Could not load branches
Branch not found: {{ refName }}
Loading
Could not load tags
Nothing to show
Loading
Are you sure you want to change the base?
Some commits from the old base branch may be removed from the timeline,
and old review comments may become outdated.
Open
Changes from all commits
Commits
Show all changes
2 commits
Select commit
Hold shift + click to select a range
File filter
Filter by extension
Conversations
Failed to load comments.
Loading
Jump to
Jump to file
Failed to load files.
Loading
Diff view
Diff view
There are no files selected for viewing
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| Original file line number | Diff line number | Diff line change |
|---|---|---|
| @@ -0,0 +1,396 @@ | ||
| """ | ||
| File: CodonComplexity.py | ||
| ------------------------ | ||
| Includes functions for checking DNA sequence complexity and enforcing synthesis rules. | ||
| """ | ||
|
|
||
| from typing import Dict, List, Optional, Tuple, Union | ||
| import re | ||
| from dataclasses import dataclass | ||
|
|
||
| from CodonTransformer.CodonUtils import DNASequencePrediction | ||
|
|
||
| def calculate_gc_content(sequence: str) -> float: | ||
| """Calculate the GC content of a DNA sequence. | ||
|
|
||
| Args: | ||
| sequence (str): The DNA sequence | ||
|
|
||
| Returns: | ||
| float: GC content as a percentage | ||
| """ | ||
| if not sequence: | ||
| return 0.0 | ||
| gc_count = sequence.count('G') + sequence.count('g') + sequence.count('C') + sequence.count('c') | ||
| return (gc_count / len(sequence)) * 100 | ||
|
|
||
| @dataclass | ||
| class ComplexityViolation: | ||
| """Represents a violation of sequence complexity rules.""" | ||
| rule_name: str | ||
| description: str | ||
| severity: float # Score contribution to total complexity | ||
| suggestion: str | ||
| location: Optional[Tuple[int, int]] = None # Start and end positions if applicable | ||
|
|
||
| @dataclass | ||
| class ComplexityConfig: | ||
| """Configuration for sequence complexity checking.""" | ||
| max_repeat_length: int = 20 # Maximum length of repeats | ||
| min_repeat_tm: float = 60.0 # Minimum melting temperature for repeat check | ||
| min_gc_content: float = 25.0 # Minimum global GC content | ||
| max_gc_content: float = 65.0 # Maximum global GC content | ||
| max_gc_deviation: float = 52.0 # Maximum deviation in GC content within gene | ||
| gc_window_size: int = 50 # Window size for GC content calculation | ||
| max_homopolymer_length: int = 5 # Maximum length of homopolymer runs | ||
| his_tag_pattern: str = "CACCAC" # Required pattern for HIS tags | ||
| enabled_rules: List[str] = None # List of rules to check, None means all | ||
|
|
||
| def __post_init__(self): | ||
| if self.enabled_rules is None: | ||
| self.enabled_rules = [ | ||
| "repeat_sequences", | ||
| "gc_content", | ||
| "gc_deviation", | ||
| "homopolymers", | ||
| "his_tag" | ||
| ] | ||
|
|
||
| def calculate_tm(sequence: str) -> float: | ||
| """ | ||
| Calculate the melting temperature of a DNA sequence. | ||
| Uses a basic nearest-neighbor method. | ||
|
|
||
| Args: | ||
| sequence (str): DNA sequence | ||
|
|
||
| Returns: | ||
| float: Estimated melting temperature in Celsius | ||
| """ | ||
| if len(sequence) < 2: | ||
| return 0.0 | ||
|
|
||
| # Basic nearest-neighbor parameters (simplified) | ||
| nn_params = { | ||
| 'AA': -7.9, 'TT': -7.9, | ||
| 'AT': -7.2, 'TA': -7.2, | ||
| 'CA': -8.5, 'TG': -8.5, | ||
| 'GT': -8.4, 'AC': -8.4, | ||
| 'CT': -7.8, 'AG': -7.8, | ||
| 'GA': -8.2, 'TC': -8.2, | ||
| 'CG': -10.6, 'GC': -9.8, | ||
| 'GG': -8.0, 'CC': -8.0 | ||
| } | ||
|
|
||
| # Calculate entropy contribution | ||
| dH = sum(nn_params.get(sequence[i:i+2], 0) for i in range(len(sequence)-1)) | ||
|
|
||
| # Add initiation parameters | ||
| dH += 0.1 * len(sequence) | ||
|
|
||
| # Approximate Tm calculation | ||
| return round((dH * 1000) / (len(sequence) * -10 + 108), 1) | ||
|
|
||
| def find_repeats(sequence: str, min_length: int = 20, min_tm: float = 60.0) -> List[Tuple[str, List[int]]]: | ||
| """ | ||
| Find repeated sequences in DNA that meet length and Tm criteria. | ||
|
|
||
| Args: | ||
| sequence (str): DNA sequence | ||
| min_length (int): Minimum length of repeats to find | ||
| min_tm (float): Minimum melting temperature threshold | ||
|
|
||
| Returns: | ||
| List[Tuple[str, List[int]]]: List of (repeat sequence, positions) tuples | ||
| """ | ||
| repeats = [] | ||
| sequence = sequence.upper() | ||
|
|
||
| # Look for repeats of various lengths | ||
| for length in range(min_length, min(50, len(sequence))): | ||
| for i in range(len(sequence) - length + 1): | ||
| pattern = sequence[i:i+length] | ||
| if calculate_tm(pattern) >= min_tm: | ||
| # Find all occurrences | ||
| positions = [m.start() for m in re.finditer(f'(?={pattern})', sequence)] | ||
| if len(positions) > 1: | ||
| repeats.append((pattern, positions)) | ||
|
|
||
| return repeats | ||
|
|
||
| def calculate_gc_windows(sequence: str, window_size: int = 50) -> List[float]: | ||
| """ | ||
| Calculate GC content in sliding windows. | ||
|
|
||
| Args: | ||
| sequence (str): DNA sequence | ||
| window_size (int): Size of sliding window | ||
|
|
||
| Returns: | ||
| List[float]: List of GC percentages for each window | ||
| """ | ||
| gc_contents = [] | ||
| for i in range(0, len(sequence) - window_size + 1): | ||
| window = sequence[i:i+window_size] | ||
| gc_contents.append(calculate_gc_content(window)) | ||
| return gc_contents | ||
|
|
||
| def find_homopolymers(sequence: str, max_length: int = 5) -> List[Tuple[str, int]]: | ||
| """ | ||
| Find homopolymer runs longer than specified length. | ||
|
|
||
| Args: | ||
| sequence (str): DNA sequence | ||
| max_length (int): Maximum allowed homopolymer length | ||
|
|
||
| Returns: | ||
| List[Tuple[str, int]]: List of (homopolymer sequence, position) tuples | ||
| """ | ||
| homopolymers = [] | ||
| for match in re.finditer(r'([ATCG])\1{' + str(max_length) + ',}', sequence): | ||
| homopolymers.append((match.group(), match.start())) | ||
| return homopolymers | ||
|
|
||
| def check_sequence_complexity( | ||
| sequence: str, | ||
| config: Optional[ComplexityConfig] = None | ||
| ) -> List[ComplexityViolation]: | ||
| """ | ||
| Check DNA sequence against complexity rules. | ||
|
|
||
| Args: | ||
| sequence (str): DNA sequence to check | ||
| config (Optional[ComplexityConfig]): Configuration for complexity checking | ||
|
|
||
| Returns: | ||
| List[ComplexityViolation]: List of complexity rule violations | ||
| """ | ||
| if config is None: | ||
| config = ComplexityConfig() | ||
|
|
||
| violations = [] | ||
| sequence = sequence.upper() | ||
|
|
||
| # Check repeat sequences | ||
| if "repeat_sequences" in config.enabled_rules: | ||
| repeats = find_repeats(sequence, config.max_repeat_length, config.min_repeat_tm) | ||
| if repeats: | ||
| repeat_percentage = sum(len(r[0]) * len(r[1]) for r in repeats) / len(sequence) * 100 | ||
|
There was a problem hiding this comment. Choose a reason for hiding this commentThe reason will be displayed to describe this comment to others. Learn more. This method seems to provide % coverage > 100% (particularly since Suggestion to add function for proper sequence coverage, such as: |
||
| if repeat_percentage > 40: | ||
| violations.append(ComplexityViolation( | ||
| rule_name="repeat_sequences", | ||
| description=f"Repeated sequences comprise {repeat_percentage:.1f}% of sequence", | ||
| severity=8.8 if repeat_percentage > 60 else 4.4, | ||
| suggestion="Redesign to reduce repeats to less than 40% of sequence" | ||
| )) | ||
|
|
||
| # Check global GC content | ||
| if "gc_content" in config.enabled_rules: | ||
| gc_content = calculate_gc_content(sequence) | ||
| if not config.min_gc_content <= gc_content <= config.max_gc_content: | ||
| violations.append(ComplexityViolation( | ||
| rule_name="gc_content", | ||
| description=f"Global GC content ({gc_content:.1f}%) outside allowed range", | ||
| severity=4.2, | ||
| suggestion=f"Adjust sequence to have GC content between {config.min_gc_content}% and {config.max_gc_content}%" | ||
| )) | ||
|
|
||
| # Check GC content deviation | ||
| if "gc_deviation" in config.enabled_rules: | ||
| gc_windows = calculate_gc_windows(sequence, config.gc_window_size) | ||
| if gc_windows: | ||
| max_gc = max(gc_windows) | ||
| min_gc = min(gc_windows) | ||
| gc_deviation = max_gc - min_gc | ||
| if gc_deviation > config.max_gc_deviation: | ||
| max_gc_pos = gc_windows.index(max_gc) * config.gc_window_size | ||
| violations.append(ComplexityViolation( | ||
| rule_name="gc_deviation", | ||
| description=f"GC content deviation ({gc_deviation:.1f}%) exceeds maximum", | ||
| severity=4.0, | ||
| suggestion="Reduce GC content variation between regions", | ||
| location=(max_gc_pos, max_gc_pos + config.gc_window_size) | ||
| )) | ||
|
|
||
| # Check homopolymers | ||
| if "homopolymers" in config.enabled_rules: | ||
| homopolymers = find_homopolymers(sequence, config.max_homopolymer_length) | ||
| if homopolymers: | ||
| violations.append(ComplexityViolation( | ||
| rule_name="homopolymers", | ||
| description=f"Contains {len(homopolymers)} long homopolymer runs", | ||
| severity=1.0, | ||
| suggestion="Break up long runs of identical nucleotides" | ||
| )) | ||
|
|
||
| # Check HIS tag pattern if present | ||
| if "his_tag" in config.enabled_rules and "CAC" in sequence: | ||
| his_pattern = re.compile(r'(CAC){2,}') | ||
| if not his_pattern.search(sequence): | ||
| violations.append(ComplexityViolation( | ||
| rule_name="his_tag", | ||
| description="Incorrect HIS tag pattern", | ||
| severity=0.5, | ||
| suggestion="Use alternating CAC/CAT codons for HIS tags" | ||
| )) | ||
|
|
||
| return violations | ||
|
|
||
| def get_total_complexity_score(violations: List[ComplexityViolation]) -> float: | ||
| """ | ||
| Calculate total complexity score from violations. | ||
|
|
||
| Args: | ||
| violations (List[ComplexityViolation]): List of complexity violations | ||
|
|
||
| Returns: | ||
| float: Total complexity score | ||
| """ | ||
| return sum(v.severity for v in violations) | ||
|
|
||
| def predict_with_complexity_check( | ||
| predict_func, | ||
| protein: str, | ||
| organism: Union[int, str], | ||
| complexity_config: Optional[ComplexityConfig] = None, | ||
| max_attempts: int = 10, | ||
| **kwargs | ||
| ) -> Tuple[DNASequencePrediction, Optional[str]]: | ||
| """ | ||
| Wrapper for DNA sequence prediction that checks sequence complexity. | ||
|
|
||
| Args: | ||
| predict_func: Function that predicts DNA sequences | ||
| protein (str): Input protein sequence | ||
| organism (Union[int, str]): Organism ID or name | ||
| complexity_config (Optional[ComplexityConfig]): Configuration for complexity checking | ||
| max_attempts (int): Maximum number of prediction attempts | ||
| **kwargs: Additional arguments for predict_func | ||
|
|
||
| Returns: | ||
| Tuple[DNASequencePrediction, Optional[str]]: | ||
| - The predicted sequence (best one if multiple attempts) | ||
| - Complexity report for the sequence | ||
| """ | ||
| best_prediction = None | ||
| best_score = float('inf') | ||
| best_report = None | ||
|
|
||
| # Try generating sequences until we find one that passes complexity checks | ||
| # or reach max attempts | ||
| for attempt in range(max_attempts): | ||
| # Get a new prediction | ||
| if kwargs.get('deterministic', True): | ||
| kwargs['deterministic'] = False | ||
| kwargs['temperature'] = 0.2 + (attempt * 0.1) # Gradually increase temperature | ||
|
|
||
| prediction = predict_func(protein=protein, organism=organism, **kwargs) | ||
|
|
||
| # Check sequence complexity | ||
| violations = check_sequence_complexity( | ||
| prediction.predicted_dna, | ||
| config=complexity_config | ||
| ) | ||
| score = get_total_complexity_score(violations) | ||
|
|
||
| # Generate report | ||
| report = format_complexity_report(prediction.predicted_dna, violations) | ||
|
|
||
| # Keep track of best sequence seen | ||
| if score < best_score: | ||
| best_prediction = prediction | ||
| best_score = score | ||
| best_report = report | ||
|
|
||
| # If this sequence passes complexity checks, return it | ||
| if score < 10: | ||
| return prediction, report | ||
|
|
||
| # If we couldn't find a sequence that passes checks, return best one seen | ||
| return best_prediction, best_report | ||
|
|
||
| def format_complexity_report( | ||
| sequence: str, | ||
| violations: List[ComplexityViolation] | ||
| ) -> str: | ||
| """ | ||
| Format complexity check results into a readable report. | ||
|
|
||
| Args: | ||
| sequence (str): The analyzed DNA sequence | ||
| violations (List[ComplexityViolation]): List of found violations | ||
|
|
||
| Returns: | ||
| str: Formatted report string | ||
| """ | ||
| total_score = get_total_complexity_score(violations) | ||
|
|
||
| report = [] | ||
| report.append("DNA Sequence Complexity Analysis") | ||
| report.append("=" * 40) | ||
| report.append(f"Sequence Length: {len(sequence)} bp") | ||
| report.append(f"Total Complexity Score: {total_score:.1f}") | ||
|
|
||
| if total_score >= 10: | ||
| report.append("\nWARNING: Sequence may be too complex for synthesis") | ||
|
|
||
| if violations: | ||
| report.append("\nComplexity Issues Found:") | ||
| for v in violations: | ||
| report.append(f"\n{v.rule_name}:") | ||
| report.append(f" Description: {v.description}") | ||
| report.append(f" Severity Score: {v.severity}") | ||
| report.append(f" Suggestion: {v.suggestion}") | ||
| if v.location: | ||
| report.append(f" Location: {v.location[0]}-{v.location[1]}") | ||
| else: | ||
| report.append("\nNo complexity issues found.") | ||
|
|
||
| return "\n".join(report) | ||
| """ | ||
| # Usage example | ||
| if __name__ == "__main__": | ||
| from CodonTransformer.CodonPrediction import predict_dna_sequence | ||
| import torch | ||
|
|
||
| # Example protein sequence | ||
| protein = "MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLA" | ||
| organism = "Escherichia coli general" | ||
|
|
||
| # Set up custom complexity rules | ||
| config = ComplexityConfig( | ||
| max_repeat_length=18, # More stringent repeat check | ||
| max_gc_content=60.0, # Lower max GC content | ||
| max_gc_deviation=45.0, # More stringent GC deviation check | ||
| max_homopolymer_length=4, # Stricter homopolymer limit | ||
| enabled_rules=[ # Only check these specific rules | ||
| "repeat_sequences", | ||
| "gc_content", | ||
| "gc_deviation", | ||
| "homopolymers" | ||
| ] | ||
| ) | ||
|
|
||
| # Set up device and model | ||
| device = torch.device("cuda" if torch.cuda.is_available() else "cpu") | ||
|
|
||
| # Initialize prediction with complexity checking | ||
| prediction, complexity_report = predict_with_complexity_check( | ||
| predict_func=predict_dna_sequence, | ||
| protein=protein, | ||
| organism=organism, | ||
| complexity_config=config, | ||
| device=device, | ||
| deterministic=False, # Use non-deterministic mode for multiple attempts | ||
| temperature=0.2, # Start with conservative sampling | ||
| top_p=0.95, # Use nucleus sampling | ||
| max_attempts=5 # Try up to 5 times to get a good sequence | ||
| ) | ||
|
|
||
| # Print results | ||
| print("===== Sequence Generation Results =====") | ||
| print("\nPredicted DNA sequence:") | ||
| print(prediction.predicted_dna) | ||
| print("\nComplexity Analysis:") | ||
| print(complexity_report) | ||
| """ | ||
Oops, something went wrong.
Oops, something went wrong.
Add this suggestion to a batch that can be applied as a single commit.
This suggestion is invalid because no changes were made to the code.
Suggestions cannot be applied while the pull request is closed.
Suggestions cannot be applied while viewing a subset of changes.
Only one suggestion per line can be applied in a batch.
Add this suggestion to a batch that can be applied as a single commit.
Applying suggestions on deleted lines is not supported.
You must change the existing code in this line in order to create a valid suggestion.
Outdated suggestions cannot be applied.
This suggestion has been applied or marked resolved.
Suggestions cannot be applied from pending reviews.
Suggestions cannot be applied on multi-line comments.
Suggestions cannot be applied while the pull request is queued to merge.
Suggestion cannot be applied right now. Please check back later.
There was a problem hiding this comment.
Choose a reason for hiding this comment
The reason will be displayed to describe this comment to others. Learn more.
find_repeatsis not providing aset()of the repeats (i.e. there are duplicates in the output). This method is also slow due to.getfor each nt pair. It would be faster to precompute the neighbor dH into an array and using a fast cumulative‑sum lookup. The below suggestion is much faster (~20X), provides a unique set of repeats, and also calculates tm withinfind_repeats.