Skip to content

Latest commit

 

History

History
683 lines (492 loc) · 20.1 KB

File metadata and controls

683 lines (492 loc) · 20.1 KB

Hubert CLI Manual

Table of Contents

Introduction

This manual provides a tutorial-style guide to using the hubert command-line tool. Hubert enables secure, distributed key-value storage for Gordian Envelopes, supporting multiple storage backends including BitTorrent Mainline DHT, IPFS, and centralized servers.

What is Hubert?

Hubert is a secure distributed substrate for multiparty transactions. It provides:

  • Write-once distributed storage: Data written once cannot be modified or deleted
  • Cryptographic addressing: Uses ARIDs (Apparently Random Identifiers) as keys
  • Multiple storage backends: BitTorrent DHT, IPFS, Hybrid, and Server modes
  • End-to-end encryption ready: Designed to work with GSTP (Gordian Sealed Transaction Protocol)
  • No central authority: Operates on public distributed networks

Primary Use Case: Facilitating secure multiparty transactions like FROST threshold signature ceremonies, where participants need to exchange encrypted messages without revealing sensitive information to network observers.

Installation

Install from crates.io:

cargo install hubert

Or build and install from source:

cd /path/to/hubert
cargo install --path .

Getting Started

Help

View the main help to see all available commands:

hubert --help

│ Hubert: Secure distributed key-value store for Gordian Envelopes
│
│ Usage: hubert [OPTIONS] <COMMAND>
│
│ Commands:
│   generate  Generate a new ARID or example Envelope
│   put       Store an envelope at an ARID
│   get       Retrieve an envelope by ARID
│   check     Check if storage backend is available
│   server    Start the Hubert HTTP server
│   help      Print this message or the help of the given subcommand(s)
│
│ Options:
│   -s, --storage <STORAGE>
│           Storage backend to use
│
│           Possible values:
│           - mainline: BitTorrent Mainline DHT (fast, ≤1 KB messages)
│           - ipfs:     IPFS (large capacity, up to 10 MB messages)
│           - hybrid:   Hybrid (automatic: DHT for small, IPFS for large)
│           - server:   Hubert HTTP server (centralized coordination)
│
│           [default: mainline]
│
│       --host <HOST>
│           Server/IPFS host (for --storage server or --storage ipfs)
│
│       --port <PORT>
│           Port (for --storage server, --storage ipfs, --storage hybrid, or server command)
│
│   -v, --verbose
│           Enable verbose logging
│
│   -h, --help
│           Print help (see a summary with '-h')
│
│   -V, --version
│           Print version

Version

Check the installed version:

hubert --version

│ hubert 0.1.0

Storage Backends

Hubert supports four storage backends, each with different characteristics:

Mainline DHT

BitTorrent Mainline DHT is a serverless, distributed hash table with over 10 million nodes worldwide.

  • Speed: Fast (typically 1-5 seconds)
  • Size limit: ≤1 KB (after bencode encoding)
  • Availability: No setup required, works out of the box
  • Persistence: Best-effort, nodes may drop data
  • Privacy: High - widely distributed across global network

Best for: Small control messages, coordination data

IPFS

InterPlanetary File System provides content-addressed storage with large capacity.

  • Speed: Moderate (depends on gateway availability)
  • Size limit: Up to 10 MB (practical limit)
  • Availability: Requires local IPFS daemon or gateway access
  • Persistence: Good with pinning, excellent with paid pinning services
  • Privacy: Moderate - data stored on IPFS nodes

Best for: Large payloads, documents, key material, proofs

Hybrid

Hybrid mode automatically selects the optimal backend based on message size.

  • Small messages (≤1 KB): Stored directly in Mainline DHT
  • Large messages (>1 KB): Content stored in IPFS, reference in DHT
  • Transparent: Applications use same API regardless of size
  • Optimized: Fast retrieval for small messages, large capacity when needed

Best for: Applications with variable message sizes

Server

Hubert Server provides centralized storage for testing and controlled deployments.

  • Speed: Very fast (local network)
  • Size limit: Configurable (typically no practical limit)
  • Availability: Requires running Hubert server
  • Persistence: Memory backed or database-backed (SQLite)
  • Privacy: Low - centralized, single point of observation

Best for: Development, testing, controlled environments

Core Concepts

ARIDs: Apparently Random Identifiers

An ARID (Apparently Random Identifier) is a 256-bit cryptographic identifier that serves as a key in Hubert's storage system.

Properties:

  • Deterministic: Same ARID always maps to same storage location
  • Privacy-preserving: ARID itself never exposed publicly
  • Collision-resistant: 256-bit cryptographic strength
  • Capability-based: ARID holder can read; ARID creator can write (once)

Distribution: ARIDs are shared between parties via secure channels (encrypted messages, QR codes, Signal, etc.), never published to storage networks.

Storage derivation: Storage networks see only derived keys, not the ARIDs themselves.

Envelopes

All data in Hubert is stored as Gordian Envelopes - a structured, extensible data format with:

  • Deterministic dCBOR serialization
  • Built-in encryption support
  • Signature capabilities
  • Merkle digest trees for integrity
  • Selective disclosure (elision)

Envelopes are stored in networks as binary dCBOR, and represented in text in UR (Uniform Resource) format: ur:envelope/...

Write-Once Semantics

Hubert enforces write-once semantics:

  • Each ARID can be written to exactly once
  • No updates or modifications after initial write
  • Attempting to overwrite fails with an error
  • Eliminates race conditions and ensures immutability

This guarantees message integrity - once published, content cannot be altered by anyone.

Basic Operations

Generating an ARID

Create a new ARID for use as a storage key:

ARID=$(hubert generate arid)
echo $ARID

│ ur:arid/hdcxiedwnbzooxpdihcmfykpvodagrmdjsidrespnbjeemfdgmdnesgeiaeocxprftbboxcsfsks

Creating an Envelope

For testing, you can generate a test envelope with random data:

hubert generate envelope 20 # Number of random bytes

│ ur:envelope/tpsoghdldkjswyksidgadskggdsaflrfvlylrpzoseetiolkutdmlf

Or create a real envelope using the envelope CLI tool (from bc-envelope-cli):

ENVELOPE=$(envelope subject type string 'Hello, Hubert')
echo $ENVELOPE
envelope format $ENVELOPE

│ ur:envelope/tpsojnfdihjzjzjldwcxfdkpidihjpjyoynyghtd
│ "Hello, Hubert"

Storing Data (Put)

Store an envelope at an ARID using the default storage backend (Mainline DHT). No output indicates success:

hubert put $ARID $ENVELOPE

Important: Each ARID can only be written once. Attempting to write again will fail:

hubert put $ARID $ENVELOPE

│ Error: ur:arid/hdcxiedwnbzooxpdihcmfykpvodagrmdjsidrespnbjeemfdgmdnesgeiaeocxprftbboxcsfsks already exists

Retrieving Data (Get)

Retrieve the envelope stored at an ARID:

hubert get $ARID

│ ur:envelope/tpsojnfdihjzjzjldwcxfdkpidihjpjyoynyghtd

You can pipe the output to the envelope tool to inspect the content:

hubert get $ARID | envelope format

│ "Hello, Hubert"

Or extract the string directly:

hubert get $ARID | envelope extract string

│ Hello, Hubert

Checking Backend Availability

Before using a storage backend, verify it's available:

hubert check

│ ✓ Mainline DHT is available

Check other backends:

hubert check --storage ipfs

│ ✓ IPFS is available at http://127.0.0.1:5001
hubert check --storage server --host localhost --port 45678

│ ✓ Hubert server is available at 127.0.0.1:45678 (version 0.1.0)

If a backend is unavailable, you'll see an error:

hubert check --storage server --port 1234

│ Error: ✗ Server is not available at 127.0.0.1:1234: error sending request for url (http://127.0.0.1:1234/health)

Storage Backend Examples

Using Mainline DHT

Mainline DHT is the default backend, requiring no setup:

# Generate identifiers
ARID=$(hubert generate arid)
ENVELOPE=$(envelope subject type string "DHT message")

# Store and retrieve
hubert put $ARID $ENVELOPE
hubert get $ARID

│ ur:envelope/tpsojefyfdghcxjnihjkjkhsioihmusnlpsp

Note: DHT operations may take 1-20 seconds as the client bootstraps into the network and propagates data.

Using IPFS

IPFS requires a running daemon. Start it first:

# In a separate terminal
ipfs daemon

Then use IPFS storage:

ARID=$(hubert generate arid)
ENVELOPE=$(envelope subject type string "IPFS message")

# Store with IPFS backend
hubert put --storage ipfs $ARID $ENVELOPE
hubert get --storage ipfs $ARID

│ ur:envelope/tpsojzgagdfggucxjnihjkjkhsioihzmeslohk

IPFS Pinning: By default, content is not pinned. Use --pin to ensure persistence. This example uses the --verbose flag to show detailed output:

ARID=$(hubert generate arid)
hubert put --storage ipfs --pin --verbose $ARID $ENVELOPE

│ [2025-10-18T10:02:03.272Z] Starting IPFS put operation
│ [2025-10-18T10:02:03.273Z] Envelope size: 17 bytes
│ [2025-10-18T10:02:03.273Z] Getting or creating IPNS key
│ [2025-10-18T10:02:03.325Z] Adding content to IPFS
│ [2025-10-18T10:02:03.366Z] Content CID: QmPUKGjPUbJQVb5PonRh21EtaNJ19UHXUNqoFmSovT4YpT
│ [2025-10-18T10:02:03.366Z] Pinning content
│ [2025-10-18T10:02:03.396Z] Publishing to IPNS (write-once check)
│ [2025-10-18T10:02:38.998Z] IPFS put operation completed
│ [2025-10-18T10:02:38.998Z] ✓ Stored envelope at ARID
│ CID: QmPUKGjPUbJQVb5PonRh21EtaNJ19UHXUNqoFmSovT4YpT

See pinned content:

ipfs pin ls

│ QmPUKGjPUbJQVb5PonRh21EtaNJ19UHXUNqoFmSovT4YpT recursive

Unpin the content:

ipfs pin rm QmPUKGjPUbJQVb5PonRh21EtaNJ19UHXUNqoFmSovT4YpT

│ unpinned QmPUKGjPUbJQVb5PonRh21EtaNJ19UHXUNqoFmSovT4YpT

Using Hybrid Storage

Hybrid mode automatically optimizes storage based on message size:

# Small message (≤1 KB) - uses DHT
SMALL_MSG=$(envelope subject type string "Small")
ARID_SMALL=$(hubert generate arid)
hubert put --storage hybrid --verbose $ARID_SMALL $SMALL_MSG

│ [2025-10-18T10:08:31.138Z] Storing envelope in DHT (size ≤ 1000 bytes)
│ [2025-10-18T10:08:31.138Z] Starting Mainline DHT put operation
│ [2025-10-18T10:08:31.138Z] Envelope size: 10 bytes
│ [2025-10-18T10:08:31.138Z] Deriving DHT signing key from ARID
│ [2025-10-18T10:08:31.139Z] Checking for existing value (write-once check)
│ [2025-10-18T10:08:34.174Z] Creating mutable DHT item
│ [2025-10-18T10:08:34.175Z] Putting value to DHT
│ [2025-10-18T10:08:36.339Z] Mainline DHT put operation completed
│ [2025-10-18T10:08:36.339Z] ✓ Stored envelope at ARID
# Large message (>1 KB) - uses IPFS with DHT reference
LARGE_MSG=$(hubert generate envelope 2000) # 2000 random bytes
ARID_LARGE=$(hubert generate arid)
hubert put --storage hybrid --verbose $ARID_LARGE $LARGE_MSG

│ [2025-10-18T10:08:57.140Z] Envelope too large for DHT, using IPFS indirection
│ [2025-10-18T10:08:57.140Z] Storing actual envelope in IPFS with reference ARID: ur:arid/hdcxgskpendlfrlesrcssbbkrtmewnzmrdbyeorsvstpdyfhcnhfmklessrelettldgalfjtcmny
│ [2025-10-18T10:08:57.140Z] Starting IPFS put operation
│ [2025-10-18T10:08:57.140Z] Envelope size: 2007 bytes
│ [2025-10-18T10:08:57.140Z] Getting or creating IPNS key
│ [2025-10-18T10:08:57.208Z] Adding content to IPFS
│ [2025-10-18T10:08:57.243Z] Content CID: QmZmKaSWuowBPsWEEp5JsZ7tkPwmjhAtyEpvqrvKhsNN3a
│ [2025-10-18T10:08:57.243Z] Publishing to IPNS (write-once check)
│ [2025-10-18T10:09:28.157Z] IPFS put operation completed
│ [2025-10-18T10:09:28.160Z] Encrypted reference envelope to hide IPFS ARID
│ [2025-10-18T10:09:28.160Z] Storing encrypted reference envelope in DHT at original ARID
│ [2025-10-18T10:09:28.160Z] Starting Mainline DHT put operation
│ [2025-10-18T10:09:28.161Z] Envelope size: 151 bytes
│ [2025-10-18T10:09:28.161Z] Deriving DHT signing key from ARID
│ [2025-10-18T10:09:28.161Z] Checking for existing value (write-once check)
│ [2025-10-18T10:09:30.978Z] Creating mutable DHT item
│ [2025-10-18T10:09:30.978Z] Putting value to DHT
│ [2025-10-18T10:09:32.524Z] Mainline DHT put operation completed
│ [2025-10-18T10:09:32.524Z] ✓ Stored envelope at ARID

Retrieval is transparent - Hybrid automatically determines the correct backend:

hubert get --storage hybrid $ARID_SMALL
hubert get --storage hybrid $ARID_LARGE

│ ur:envelope/tpsoihgujnhsjzjzsrrtsskg
│ ur:envelope/tpsohkattifzfppdlrrhvybnflhdjoptmtzshtwfotpdfltkgreerylddsotnlkknlsooy...

Using Hubert Server

The Hubert server provides centralized low-latency storage for testing, development, and controlled environments.

Starting the server (note: this command blocks, so run in separate terminal):

# Start server on default port (8080)
hubert server

Starting Hubert server on port 45678 with in-memory storage
✓ Hubert server listening on 127.0.0.1:45678

Using the server (in another terminal):

ARID=$(hubert generate arid)
ENVELOPE=$(envelope subject type string "Server message")
hubert put --storage server $ARID $ENVELOPE
hubert get --storage server $ARID

│ ur:envelope/tpsojtguihjpkoihjpcxjnihjkjkhsioihjpryisve

Server-specific options:

# Store with TTL (time-to-live) in seconds
ARID=$(hubert generate arid)
hubert put --storage server --ttl 3600 $ARID $ENVELOPE

Advanced Usage

Verbose Output

Enable verbose logging to see detailed operation information:

ARID=$(hubert generate arid)
hubert --storage server --verbose put $ARID $ENVELOPE

│ [2025-10-18T10:11:26.160Z] Starting server put operation
│ [2025-10-18T10:11:26.161Z] Sending PUT request to server
│ [2025-10-18T10:11:26.166Z] Server put operation completed
│ [2025-10-18T10:11:26.166Z] ✓ Stored envelope at ARID

Timeouts

Control how long to wait for retrieval operations:

# Wait up to 60 seconds (default is 30)
hubert get --timeout 60 $ARID

│ ur:envelope/tpsojtguihjpkoihjpcxjnihjkjkhsioihjpryisve

If the timeout expires:

NONEXISTENT_ARID=$(hubert generate arid)
hubert get --timeout 5 $NONEXISTENT_ARID

│ Error: Value not found within 5 seconds

IPFS Pinning

By default, IPFS content is not pinned and may be garbage collected. Use --pin to ensure persistence (as long as your IPFS node is running). The command's output shows the pinned CID:

ARID=$(hubert generate arid)
ENVELOPE=$(envelope subject type string "Pinned IPFS message")
hubert put --storage ipfs --pin $ARID $ENVELOPE

│ CID: QmZWpMdDR1Y1zWCziJByWFs6rRFZ8zXRCxuh9dbhg5u9BR

Pinned content remains available until explicitly unpinned:

ipfs pin ls QmZWpMdDR1Y1zWCziJByWFs6rRFZ8zXRCxuh9dbhg5u9BR

│ QmZWpMdDR1Y1zWCziJByWFs6rRFZ8zXRCxuh9dbhg5u9BR recursive

The returned CID can be used to unpin later if desired.

ipfs pin rm QmZWpMdDR1Y1zWCziJByWFs6rRFZ8zXRCxuh9dbhg5u9BR
ipfs pin ls QmZWpMdDR1Y1zWCziJByWFs6rRFZ8zXRCxuh9dbhg5u9BR

│ Error: path 'QmZWpMdDR1Y1zWCziJByWFs6rRFZ8zXRCxuh9dbhg5u9BR' is not pinned

Server TTL

When using the server backend, specify how long data should be retained:

# Store with 1 hour TTL
ARID=$(hubert generate arid)
ENVELOPE=$(envelope subject type string "Temporary message")
hubert put --storage server --ttl 3600 $ARID $ENVELOPE
# Store with 24 hour TTL
ARID=$(hubert generate arid)
ENVELOPE=$(envelope subject type string "One day message")
hubert put --storage server --ttl 86400 $ARID $ENVELOPE

After the TTL expires, the server automatically removes the data.

Bidirectional Communication Pattern

Hubert enables request-response flows without direct connections between parties.

Request-Response Flow

Example scenario: Alice wants Bob to sign a document.

Step 1: Alice prepares the request

# Alice generates ARID for the request and expected response
REQUEST_ARID=$(hubert generate arid)
RESPONSE_ARID=$(hubert generate arid)

# Alice creates an envelope with the document and response ARID
# (In practice, this would be encrypted with GSTP to Bob's public key)
REQUEST_ENVELOPE=$(envelope subject type string "Please sign: document.pdf" | \
  envelope assertion add pred-obj string "responseArid" arid "$RESPONSE_ARID")

echo $REQUEST_ARID
echo $RESPONSE_ARID
echo $REQUEST_ENVELOPE
envelope format $REQUEST_ENVELOPE

│ ur:arid/hdcxrdbybkbbkbchcfknykdispmkghiacahgecishyetwnvestpsttwepkhtzeknttveswvozsgu
│ ur:arid/hdcxfzditpftaeonvosnbslteykgpkptfrmeguntbdimoytlfmmncypeckvdylpyhfesmyethdbd
│ ur:envelope/lftpsokscfgdjzihhsjkihcxjkiniojtftcxiejliakpjnihjtjydmjoieiyoytpsojzjpihjkjojljtjkihfpjpinietpsotansgshdcxfzditpftaeonvosnbslteykgpkptfrmeguntbdimoytlfmmncypeckvdylpyhfesbzcaqdbk
│ "Please sign: document.pdf" [
│     "responseArid": ARID(4027d83a)
│ ]

Step 2: Alice publishes the request

hubert put $REQUEST_ARID $REQUEST_ENVELOPE

Step 3: Alice shares REQUEST_ARID with Bob

Alice sends the REQUEST_ARID to Bob via a secure channel (Signal, QR code, encrypted email, etc.). The ARID is never published to the storage network.

Step 4: Bob retrieves the request

# Bob receives REQUEST_ARID from Alice via secure channel
RECEIVED_REQUEST_ARID=$REQUEST_ARID

# Bob retrieves the request
RECEIVED_REQUEST_ENVELOPE=$(hubert get $RECEIVED_REQUEST_ARID)
envelope format $RECEIVED_REQUEST_ENVELOPE

│ "Please sign: document.pdf" [
│     "responseArid": ARID(4027d83a)
│ ]
RECEIVED_RESPONSE_ARID=$( \
  envelope assertion find predicate string "responseArid" $RECEIVED_REQUEST_ENVELOPE | \
  envelope extract object | \
  envelope extract arid \
)

echo $RECEIVED_RESPONSE_ARID

│ ur:arid/hdcxfzditpftaeonvosnbslteykgpkptfrmeguntbdimoytlfmmncypeckvdylpyhfesmyethdbd

Step 5: Bob creates and publishes the response

# Bob creates his response (signature, etc.)
RESPONSE_ENVELOPE=$(envelope subject type string "Signed: document.pdf.sig")
envelope format $RESPONSE_ENVELOPE

│ "Signed: document.pdf.sig"
# Bob publishes at the RESPONSE_ARID that Alice specified
hubert put $RECEIVED_RESPONSE_ARID $RESPONSE_ENVELOPE

Step 6: Alice retrieves the response

# Alice already knows the RESPONSE_ARID (she generated it)
RECEIVED_RESPONSE_ENVELOPE=$(hubert get $RESPONSE_ARID)
envelope extract string $RECEIVED_RESPONSE_ENVELOPE

│ Signed: document.pdf.sig

Key points:

  • ARIDs shared only via secure channels
  • No direct connection needed between Alice and Bob
  • Parties don't need to be online simultaneously
  • Storage network sees only encrypted envelopes
  • Write-once semantics prevent tampering
  • Encryption and authentication using GSTP ensures confidentiality and integrity